Wako Pure Chemical Industries, Ltd.Wako Pure Chemical Industries, Ltd. - Laboratory Chemicals
Home > Products > Life Science > Disease Research  >  Synuclein, human, recombinant

For neurodegenerative disease research
Synuclein, human, recombinant

Synuclein is a soluble protein highly expressing in nerve cells. The three kinds of α, β and γ have been known.
α-synuclein is considered to be involved in the transmission control of synaptic vesicles. It is a major component of Lewy bodies which are stored inside the nerve cells in the neurodegenerative diseases such as Parkinson's disease and dementia with Lewy bodies. Many of the α-synuclein in Lewy bodies have been phosphorylated. β-synuclein has been suggested to prevent the agglomeration of α-synuclein. β-synuclein mutants have been reported to be involved in the neurodegenerative diseases such as Parkinson's disease and dementia with Lewy bodies. γ-synuclein highly expresses in the peripheral nervous system. It's physiological action has not been so clear.



1. Package Inserts


2. Product Outline

  • Appearance : Lyophilized
  • Buffer before lyophilized : 20 mmol/L ammonium bicarbonate
  • Host : E. coli
  • Solubility :
        20 mmol/L ammonium bicarbonate (2.5 mg/mL)
        10 mmol/L phosphate buffer (pH 7.4)
        50 mmol/L NaCl (2.5 mg/mL)
  • Remarks : 6 x His-tagged

3. Amino acid sequence

α-synuclein

AHHHHHH+MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

β-synuclein

AHHHHHH+MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

γ-synuclein

AHHHHHH+MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD


* AHHHHHH: 6 x His tag

4. Product List

Product Name Package Size Wako Catalog No. Grade Storage conditions
α-Synuclein, Human, recombinant 0.5 mg 190-17941 for Cellbiology Keep at -20°C.
β-Synuclein, Human, recombinant 0.5 mg 197-17951
γ-Synuclein, Human, recombinant 0.5 mg 194-17961

5. Related Product

Product Name Package Size Wako Catalog No. Grade Storage conditions
Phosphorylated α-synuclein antibody
Anti Phosphorylated α-Synuclein, Monoclonal Antibody (pSyn#64)
50 μL 015-25191 for Immunochemistry Keep at -20°C.
Reagent for making model animals of Parkinson's disease
1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine Hydrochloride 【MPTP】
10 mg 136-16381 for Cellbiology Keep at -20°C.
An active ingredient in the therapeutic agent for Parkinson's disease
1-Adamantanamine Hydrochloride 10 g 017-08051 Wako Special Grade Keep at room temperature.
3-(3,4-Dihydroxyphenyl)-L-alanine 100 mg 047-30561 Wako 1st Grade
1 g 043-30563
5 g 041-30564
25 g 045-30562
Droxidopa 10 mg 041-32801 for Biochemistry Keep at -20°C.
50 mg 047-32803
Pergolide Mesylate 100 mg 166-25691
250 mg 162-25693
Home > Products > Life Science > Disease Research  >  Synuclein, human, recombinant